PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604807.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 571aa    MW: 63019.6 Da    PI: 9.2861
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604807.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix92.15.6e-2957141187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+++e+laL+++r+em++++r++ lk+plWe+vs+k+ e g++r++k+Ckek+en++k++k++ke++++r++++  t+++f+qlea
  XP_013604807.1  57 RWPREETLALLRIRSEMDSTFRDATLKAPLWEHVSRKLLELGYKRNAKKCKEKFENVQKYHKRTKETRGGRHEGK--TYKFFSQLEA 141
                     8********************************************************************985555..6*******85 PP

2trihelix1041.1e-32414498186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     rW+k+e+laLi++r+ me r++++  k+ lWee+s  m++ g++r++k+Ckekwen+nk+ykk+ke++kkr +++ +tcpy+++l+
  XP_013604807.1 414 RWPKEEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKKR-PQDAKTCPYYHRLD 498
                     8*********************************************************************8.99999*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.93450114IPR017877Myb-like domain
SMARTSM007170.01754116IPR001005SANT/Myb domain
PfamPF138373.2E-1956142No hitNo description
CDDcd122032.02E-2456121No hitNo description
SMARTSM007170.0011411473IPR001005SANT/Myb domain
PfamPF138375.9E-22413498No hitNo description
Gene3DG3DSA:1.10.10.607.8E-4413470IPR009057Homeodomain-like
PROSITE profilePS500907.131413471IPR017877Myb-like domain
CDDcd122038.44E-29414478No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MEQGGGGGGN EVVEEASPIS SRPPANMEEL MRFSAAADDG GGFGGGGGSS SSSSGNRWPR  60
EETLALLRIR SEMDSTFRDA TLKAPLWEHV SRKLLELGYK RNAKKCKEKF ENVQKYHKRT  120
KETRGGRHEG KTYKFFSQLE ALNTSTTPAP PSSLDVTPLS VANPVQQPSS SSSQFPVFSL  180
TQTPPPSQPL PPHTVSFTPN PLPPPPPPSV DPPFPGGTFS SHSSSTASGM GSDDDDDMDV  240
DQAGPSSHKR KRENRGTGGG KMMELFEGLV RQVMQKQAAM QRSFLEALEK REQERLAREE  300
AWKRQEMSRL AREHEIMAQE RAASASRDAA IISLIQKITG HTIQLPHSLS SQPSPPPPAA  360
KRPSSQAVEP PLSQPIMAIP QQQVLPPPPP HQPQQQQQQE MIMSSDQSLP SSSRWPKEEI  420
LALINLRSGM EPRYQDNVPK GLLWEEISTS MKRMGYNRNA KRCKEKWENI NKYYKKVKES  480
NKKRPQDAKT CPYYHRLDLL YSSKVLGSGA GSSTSSLPQD QISTIQKQSP VSAMKPSQEG  540
DVYVHQTHGS ASSEEEEPRE ETPQGAEKKT L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199107KRNAKKCKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604807.10.0PREDICTED: trihelix transcription factor GTL1-like isoform X2
SwissprotQ9C8820.0GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLA0A0D3DKQ70.0A0A0D3DKQ7_BRAOL; Uncharacterized protein
STRINGBra036731.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33240.10.0GT-2-like 1